PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold34656-augustus-gene-0.3-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family Nin-like
Protein Properties Length: 242aa    MW: 28018.6 Da    PI: 4.6059
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold34656-augustus-gene-0.3-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.84e-2764114252
                                        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                                   +k +s e++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  maker-scaffold34656-augustus-gene-0.3-mRNA-1  64 SKMLSKETISQYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLMSL 114
                                                   57899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.47348135IPR003035RWP-RK domain
PfamPF020421.4E-2267114IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
LLDHVADDFF FSCGNRPEVW NEIVAGFEPQ NQALILSSSN EKKDEEVKEE RRKKRCREER  60
CSSSKMLSKE TISQYFYMPI TQAAKELNVG LTLLKKRCRE LGIRRWPHRK LMSLQTLIKN  120
VQCLSMSVFI TSTNAWVTQE LAKEEGEESE VKLREAIEIL EGERKLLEEI PDAQLEDNTK  180
RLRQACFKAN YKKRKLMGMV DSQSCSSSNQ SSMDGTGDEK EEEEDDEDDE EEEESLVGPL  240
FF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007037362.16e-83RWP-RK domain-containing protein, putative
SwissprotQ9M9U99e-57RKD1_ARATH; Protein RKD1
TrEMBLA0A061FXS16e-83A0A061FXS1_THECC; RWP-RK domain-containing protein, putative
STRINGVIT_17s0000g06250.t011e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-53RWP-RK domain-containing protein